| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ190976.1 | 5prime_partial | 231 | 3-698(+) |
Amino Acid sequence : | |||
| SDDPGEGGDDSGESELDKNLGEVNLRFLFQTWRKRMLAYKIPSSISLVWNLQTLIIHGDIRAIAPSEIWEMPQLRHIKILSVSLPDPPCSEGLLILKNLQTIRKVKNLIWTEEICKRMPN IEELGVEYNFHKHGDPSSGYQLQNLGCLNRLKSLYFYCSGRENIAGSMKNLKLPSSLKELILLRSKLLWSDMAMIASLPHLEILTLHSNAFVGEEWNCVEHEFLFPETPPN* | |||
Physicochemical properties | |||
| Number of amino acids: | 231 | ||
| Molecular weight: | 26,367.163 | ||
| Theoretical pI: | 5.826 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40450 40700 | ||
| Instability index: | 57.697 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.238 | ||
Secondary Structure Fraction | |||
| Helix | 0.338 | ||
| turn | 0.273 | ||
| sheet | 0.294 | ||