Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190976.1 | 5prime_partial | 231 | 3-698(+) |
Amino Acid sequence : | |||
SDDPGEGGDDSGESELDKNLGEVNLRFLFQTWRKRMLAYKIPSSISLVWNLQTLIIHGDIRAIAPSEIWEMPQLRHIKILSVSLPDPPCSEGLLILKNLQTIRKVKNLIWTEEICKRMPN IEELGVEYNFHKHGDPSSGYQLQNLGCLNRLKSLYFYCSGRENIAGSMKNLKLPSSLKELILLRSKLLWSDMAMIASLPHLEILTLHSNAFVGEEWNCVEHEFLFPETPPN* | |||
Physicochemical properties | |||
Number of amino acids: | 231 | ||
Molecular weight: | 26,367.163 | ||
Theoretical pI: | 5.826 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40450 40700 | ||
Instability index: | 57.697 | ||
aromaticity | 0.078 | ||
GRAVY | -0.238 | ||
Secondary Structure Fraction | |||
Helix | 0.338 | ||
turn | 0.273 | ||
sheet | 0.294 |