Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190979.1 | 5prime_partial | 209 | 3-632(+) |
Amino Acid sequence : | |||
SIAKSFRRPKNLPWQSGLFEESIRAAGLSGLEAGSKLYISNLDIGVSNEDIRELFSEIGELIRYAIHFDKNGRSSGSAEVVFARRSDAFQALKRYNNVQLDGKPMKIEIVGANAEVPLSA RVNVVGGATEKKRTVVMTSGPGRSRGGLVAATRGSGQRGRGSSNAGRGGPRRGRGGGRGRGQWRKKTVEKSADQLDKELDSYHAEAMQT* | |||
Physicochemical properties | |||
Number of amino acids: | 209 | ||
Molecular weight: | 22,532.062 | ||
Theoretical pI: | 10.430 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 38.655 | ||
aromaticity | 0.057 | ||
GRAVY | -0.638 | ||
Secondary Structure Fraction | |||
Helix | 0.234 | ||
turn | 0.311 | ||
sheet | 0.239 |