Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190991.1 | complete | 191 | 132-707(+) |
Amino Acid sequence : | |||
MIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKFRRSKGSLGHAFTVRIRTGNQNQTSFYPSVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRPDRPAGAGLGSKKRGDAP PPIHGISKITLKVVVFHFRLSAPTYPTPLKSFHKVGLESSSTGSSFPADSAKPVPLAVVSLDSRQGQWESR* | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 20,721.285 | ||
Theoretical pI: | 9.997 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 48.300 | ||
aromaticity | 0.084 | ||
GRAVY | -0.350 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.351 | ||
sheet | 0.178 |