Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ190999.1 | 5prime_partial | 199 | 2-601(+) |
Amino Acid sequence : | |||
HPFSMKQPFLGGNTHPASYVPSQLTIFYGGTVNVFDDISPEKAQAIMLLAGNMYVQSKSKLHMQAPASKLPAAYEPLVNQSMNTPPCSGLPSPMSVSSHPIDQSGANNDEIKVSNTTLVN NTDSPRLMSSLGPIAASAIMSPAVPQARKASLARFLEKRKERVMSAAPYKQSKNGGDCKTPESSDLGFSATSGICSTSG* | |||
Physicochemical properties | |||
Number of amino acids: | 199 | ||
Molecular weight: | 21,017.651 | ||
Theoretical pI: | 8.997 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
Instability index: | 62.276 | ||
aromaticity | 0.055 | ||
GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
Helix | 0.216 | ||
turn | 0.362 | ||
sheet | 0.241 |