| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ191005.1 | 5prime_partial | 246 | 3-743(+) |
Amino Acid sequence : | |||
| NSKSKNGVRQFSSDSGLPPHQEIGMPSLSPTMTEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKILRGDGSSGIKVGEIIAITVEEEGDIAKFKDYTPSSDAAPAPEA PSPPTPPKEEVSTTPVEPKVSKPSAPPSSGDRIFASPLARKLAEDHNVSLSEIKGTGPDGRIVEADIEDYLASRGKAAHAPKVDTTTVAGLDYTDIPHSQIRKLQHRDYCSQTNNTALLP DCRYMC* | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 26,419.286 | ||
| Theoretical pI: | 5.008 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14690 | ||
| Instability index: | 52.832 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.601 | ||
Secondary Structure Fraction | |||
| Helix | 0.211 | ||
| turn | 0.289 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ191005.1 | 5prime_partial | 246 | 3-743(+) |
Amino Acid sequence : | |||
| NSKSKNGVRQFSSDSGLPPHQEIGMPSLSPTMTEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKILRGDGSSGIKVGEIIAITVEEEGDIAKFKDYTPSSDAAPAPEA PSPPTPPKEEVSTTPVEPKVSKPSAPPSSGDRIFASPLARKLAEDHNVSLSEIKGTGPDGRIVEADIEDYLASRGKAAHAPKVDTTTVAGLDYTDIPHSQIRKLQHRDYCSQTNNTALLP DCRYMC* | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 26,419.286 | ||
| Theoretical pI: | 5.008 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14690 | ||
| Instability index: | 52.832 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.601 | ||
Secondary Structure Fraction | |||
| Helix | 0.211 | ||
| turn | 0.289 | ||
| sheet | 0.248 | ||