| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ191008.1 | internal | 101 | 3-305(+) |
Amino Acid sequence : | |||
| LGLHPEIYERVRAEQLAVAETKKPGEMLEWEDMGKMKYSWNVICETMRMVPPLQGTFRDVLEEFTYAGYTIPKGWKVYWTVSTTHMNPQFFKEPERFNPSR | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 12,005.685 | ||
| Theoretical pI: | 6.158 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29450 | ||
| Instability index: | 30.044 | ||
| aromaticity | 0.139 | ||
| GRAVY | -0.626 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.198 | ||
| sheet | 0.277 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ191008.1 | internal | 101 | 3-305(+) |
Amino Acid sequence : | |||
| LGLHPEIYERVRAEQLAVAETKKPGEMLEWEDMGKMKYSWNVICETMRMVPPLQGTFRDVLEEFTYAGYTIPKGWKVYWTVSTTHMNPQFFKEPERFNPSR | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 12,005.685 | ||
| Theoretical pI: | 6.158 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29450 | ||
| Instability index: | 30.044 | ||
| aromaticity | 0.139 | ||
| GRAVY | -0.626 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.198 | ||
| sheet | 0.277 | ||