| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ191014.1 | internal | 126 | 3-380(+) |
Amino Acid sequence : | |||
| PIFWGLMTLSTFGNDLEPTSHWLEVMFSICTVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDIEWWMKRRQLPSELRQRVRRYEHQRWATLGCDDEMELIQDLPEGLRRDIKRFLC LDLIKK | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 15,150.847 | ||
| Theoretical pI: | 9.317 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29240 | ||
| Instability index: | 64.731 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.160 | ||
Secondary Structure Fraction | |||
| Helix | 0.357 | ||
| turn | 0.135 | ||
| sheet | 0.302 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JZ191014.1 | internal | 126 | 3-380(+) |
Amino Acid sequence : | |||
| PIFWGLMTLSTFGNDLEPTSHWLEVMFSICTVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDIEWWMKRRQLPSELRQRVRRYEHQRWATLGCDDEMELIQDLPEGLRRDIKRFLC LDLIKK | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 15,150.847 | ||
| Theoretical pI: | 9.317 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29240 | ||
| Instability index: | 64.731 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.160 | ||
Secondary Structure Fraction | |||
| Helix | 0.357 | ||
| turn | 0.135 | ||
| sheet | 0.302 | ||