Acc_NO	ORF type	length	start-end position (strand +/-)
>JZ468945.1	5prime_partial	223	2-673(+)
Amino Acid sequence :
SQLDDEVNQHGDGVRPHHAEVRCDLGSSGDHRQITWGEIWRLVRLGFEYLETFPGVSTRMSPRALDDRCTEVGLLHNCDLFAAEQILRNHAYSLLDTLLLHHQILVGSLKSHPPCCCRDL PFRGRTYPPRHQRRDPLGFCLSQVLSRVVCSPVDYGPASGLFQSLEHRDWFVDSPFLYWQQQLIVFALSSCFVRLKKTRSEFTNSRMRKFPQTAPVMSLAFQE*
Physicochemical properties
Number of amino acids:		223
Molecular weight:		17,701.986
Theoretical pI:		7.916
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		2980 2980
Instability index:		48.295
aromaticity		0.052
GRAVY		-1.579
Secondary Structure Fraction
Helix		0.129
turn		0.252
sheet		0.213

Acc_NO	ORF type	length	start-end position (strand +/-)
>JZ468945.1	complete	155	569-102(-)
Amino Acid sequence :
MTRQTRSTAAANKERENQRTSHDVPATETSQMQDHNPPVNRRPGKEPEKDKTPEGHVADVSVDKFGREKEGRGSSKEDDSSNFQQEFDDAVKAYLAKNRHDFLEFAQQQRDRNCEGGQPP YSDRREHEATSGSKHREKSLSIRILGARDARFPPR*
Physicochemical properties
Number of amino acids:		155
Molecular weight:		17,701.986
Theoretical pI:		7.916
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		2980 2980
Instability index:		48.295
aromaticity		0.052
GRAVY		-1.579
Secondary Structure Fraction
Helix		0.129
turn		0.252
sheet		0.213