Acc_NO	ORF type	length	start-end position (strand +/-)
>JZ468946.1	internal	105	2-316(+)
Amino Acid sequence :
QRSLATDLQNLSMELRKKQSTYLKRLQQQKEGQDGVDLEMNLNDRSKSGDDEFDDVGFTDYQMSKLKKSEAFTAEREREITQVVESVNDLAQIMKDLSVLVIAQG
Physicochemical properties
Number of amino acids:		105
Molecular weight:		12,016.293
Theoretical pI:		4.737
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		2980 2980
Instability index:		45.405
aromaticity		0.048
GRAVY		-0.823
Secondary Structure Fraction
Helix		0.257
turn		0.171
sheet		0.286