Acc_NO	ORF type	length	start-end position (strand +/-)
>JZ468958.1	5prime_partial	174	3-527(+)
Amino Acid sequence :
YDVGVETSRKVMEGRTRLQQQQVVREVLLSMLPPGAPEQFRKLFPPTRWAEEFNAALTVPFFHWLVGPSEVVEVEVNGVKQKSGVLIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL PLTMNPNFEDMSCEMIYGQVPPRFEDDPVSKQPCLPNFCSIANPNSRLCPKLKA*
Physicochemical properties
Number of amino acids:		174
Molecular weight:		11,428.959
Theoretical pI:		8.898
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8855
Instability index:		26.066
aromaticity		0.105
GRAVY		-0.039
Secondary Structure Fraction
Helix		0.257
turn		0.324
sheet		0.181

Acc_NO	ORF type	length	start-end position (strand +/-)
>JZ468958.1	3prime_partial	105	316-2(-)
Amino Acid sequence :
MLTHIPTHPLFSRYLHFFMRTPLFCFTPFTSTSTTSEGPTNQWKKGTVNAALNSSAHLVGGNNFLNCSGAPGGSMERSTSLTTCCCCKRVLPSITFLDVSTPTSY
Physicochemical properties
Number of amino acids:		105
Molecular weight:		11,428.959
Theoretical pI:		8.898
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8855
Instability index:		26.066
aromaticity		0.105
GRAVY		-0.039
Secondary Structure Fraction
Helix		0.257
turn		0.324
sheet		0.181