Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ468963.1 | 5prime_partial | 306 | 1-921(+) |
Amino Acid sequence : | |||
YTMSEWKKPVLYVGGGCLNSSEELKKFVELTGIPVASTLMGLGSYPSSDEECALQMLGMHGTVYANYSVDKSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKQPHVSIC ADIKLALQGLNLILEAKGGEINLDFSPWREELKEQKTKFPLTYKTFGDAIPPQYAIQVLDELTGGNAIISTGVGQHQMWAAQFYKYNKPRQWLTSGGLGAMGFGLPAAMGAAVARPDAVV VDIDGDGSFMMNVQELATIRVENLPIKIMLLNNQHLGMWFSGKIAFTAIEHILFLETLKSRIFPDW* | |||
Physicochemical properties | |||
Number of amino acids: | 306 | ||
Molecular weight: | 11,175.888 | ||
Theoretical pI: | 9.339 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 54.729 | ||
aromaticity | 0.097 | ||
GRAVY | 0.183 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.350 | ||
sheet | 0.272 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ468963.1 | complete | 108 | 978-652(-) |
Amino Acid sequence : | |||
MLLQFPTVTTAVYPKLGKPLPVRENSTLEGFQKKYVLDCCKSDLPTEPHTKMLVVQQHNLNGKILHTDSSQLLNIHHKTPITIYVYYYCIWSCNSSSHGSRESETHCS* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 11,175.888 | ||
Theoretical pI: | 9.339 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 54.729 | ||
aromaticity | 0.097 | ||
GRAVY | 0.183 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.350 | ||
sheet | 0.272 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JZ468963.1 | complete | 103 | 509-198(-) |
Amino Acid sequence : | |||
MASPNVLYVRGNFVFCSFSSSLQGEKSRLISPPFASNIKFKPCKANLMSAQMETCGCLFFPISAESMSIWTIFALLANASNLPVTRSSNLTPKASNKSLLSTE* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,175.888 | ||
Theoretical pI: | 9.339 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 54.729 | ||
aromaticity | 0.097 | ||
GRAVY | 0.183 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.350 | ||
sheet | 0.272 |