Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KC292261.1 | complete | 247 | 1-744(+) |
Amino Acid sequence : | |||
MGYLRSSFVFFLLAFVTYTYAATIEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTSMARIWGRTNCNFDGAGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDIS LVDGFNIPMTFAPTNPSGGKCHSIQCTANINGECPAALRVPGGCNNPCTTFGGQQYCCTQGPCGPTELSRFFKQRCPDAYSYPQDDPTSTFTCPSGSTNYRVVFCPNGVTSPNLPLERPA STDKVAN* | |||
Physicochemical properties | |||
Number of amino acids: | 247 | ||
Molecular weight: | 26,664.668 | ||
Theoretical pI: | 7.847 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40910 41910 | ||
Instability index: | 40.919 | ||
aromaticity | 0.113 | ||
GRAVY | -0.288 | ||
Secondary Structure Fraction | |||
Helix | 0.247 | ||
turn | 0.328 | ||
sheet | 0.154 |