Acc_NO	ORF type	length	start-end position (strand +/-)
>KC353363.1	complete	126	227-607(+)
Amino Acid sequence :
MSDEHRIRFVEMKLEGSARKYWAFVVQDRDRSGLELISTWVEMKATFKGKYLPVFYKDQMFDQLSTFKQGSLTGTEYMKKFDELRDACKIVEQENVELSHFRSRLRQELRIAFATYRLTT VQETFH*
Physicochemical properties
Number of amino acids:		126
Molecular weight:		15,120.137
Theoretical pI:		8.686
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18450 18450
Instability index:		41.644
aromaticity		0.135
GRAVY		-0.579
Secondary Structure Fraction
Helix		0.317
turn		0.119
sheet		0.270