Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KC456352.1 | internal | 217 | 1-651(+) |
Amino Acid sequence : | |||
VPFLHSLRFFLHEYHNWNSLLITHKKSICLFSKENKRLFRFLYNSYVSEFEFLLVFFRKQSSYLRLRSSGTFLERTLFYGKIEHFQIKHLHFIVVCPNYFLWSFKEPFMHYVRYQGKALL ASKGTHLVMKKWKYHFVNLWQYYFHFWSQLYRIHINQLSNYSFYFLGYLSSVLINFSTVRNQMLENSFLIDIITKKFDSIIPVIVLIESLSKAQFCT | |||
Physicochemical properties | |||
Number of amino acids: | 217 | ||
Molecular weight: | 26,535.732 | ||
Theoretical pI: | 9.764 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 49850 49975 | ||
Instability index: | 45.860 | ||
aromaticity | 0.212 | ||
GRAVY | 0.064 | ||
Secondary Structure Fraction | |||
Helix | 0.470 | ||
turn | 0.194 | ||
sheet | 0.203 |