Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KC571789.1 | internal | 186 | 3-560(+) |
Amino Acid sequence : | |||
VGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKAL RALRLEDLRIPVAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGG | |||
Physicochemical properties | |||
Number of amino acids: | 186 | ||
Molecular weight: | 20,626.330 | ||
Theoretical pI: | 8.284 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
Instability index: | 28.969 | ||
aromaticity | 0.118 | ||
GRAVY | -0.290 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.226 | ||
sheet | 0.237 |