Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KC571792.1 | internal | 122 | 1-366(+) |
Amino Acid sequence : | |||
AGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEETGAAVTGESSTGSWAIVWTDGFTSLDQSEGRSYNIEPVPGEKDQYICYVAYPFDLFEEGSVTNMFTSIVGNVFGFKALRALR LE | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,495.822 | ||
Theoretical pI: | 4.389 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
Instability index: | 39.739 | ||
aromaticity | 0.139 | ||
GRAVY | -0.282 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.246 | ||
sheet | 0.238 |