| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KC571792.1 | internal | 122 | 1-366(+) |
Amino Acid sequence : | |||
| AGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEETGAAVTGESSTGSWAIVWTDGFTSLDQSEGRSYNIEPVPGEKDQYICYVAYPFDLFEEGSVTNMFTSIVGNVFGFKALRALR LE | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,495.822 | ||
| Theoretical pI: | 4.389 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
| Instability index: | 39.739 | ||
| aromaticity | 0.139 | ||
| GRAVY | -0.282 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.246 | ||
| sheet | 0.238 | ||