| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KC571799.1 | internal | 180 | 2-541(+) |
Amino Acid sequence : | |||
| AGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALR LEDLRIPTAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLR | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 20,061.651 | ||
| Theoretical pI: | 7.806 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
| Instability index: | 27.397 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.307 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.217 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KC571799.1 | internal | 180 | 2-541(+) |
Amino Acid sequence : | |||
| AGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALR LEDLRIPTAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLR | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 20,061.651 | ||
| Theoretical pI: | 7.806 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
| Instability index: | 27.397 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.307 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.217 | ||
| sheet | 0.244 | ||