| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KC571800.1 | internal | 133 | 3-401(+) |
Amino Acid sequence : | |||
| KAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVVGEKDQYICYVAYPLNLFEEGSVTNMFTSIVENVFGFKALRAL RLEDLRIPLAYVK | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 14,903.721 | ||
| Theoretical pI: | 4.889 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
| Instability index: | 28.081 | ||
| aromaticity | 0.128 | ||
| GRAVY | -0.220 | ||
Secondary Structure Fraction | |||
| Helix | 0.338 | ||
| turn | 0.195 | ||
| sheet | 0.271 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KC571800.1 | internal | 133 | 3-401(+) |
Amino Acid sequence : | |||
| KAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVVGEKDQYICYVAYPLNLFEEGSVTNMFTSIVENVFGFKALRAL RLEDLRIPLAYVK | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 14,903.721 | ||
| Theoretical pI: | 4.889 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
| Instability index: | 28.081 | ||
| aromaticity | 0.128 | ||
| GRAVY | -0.220 | ||
Secondary Structure Fraction | |||
| Helix | 0.338 | ||
| turn | 0.195 | ||
| sheet | 0.271 | ||