Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KC571804.1 | internal | 157 | 1-471(+) |
Amino Acid sequence : | |||
GFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVLGFKALR ALRLENLRIPVAYVKTFQGPPHGIQVERIKWNKYGRP | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 17,599.798 | ||
Theoretical pI: | 6.933 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32890 33015 | ||
Instability index: | 28.603 | ||
aromaticity | 0.127 | ||
GRAVY | -0.349 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.223 | ||
sheet | 0.229 |