Acc_NO	ORF type	length	start-end position (strand +/-)
>KC571808.1	internal	182	1-546(+)
Amino Acid sequence :
RHWVKDVSSLHLLRVFLNEYWNWNSLLTPKKVSFSLSKRNPRLFFFLYNSPVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLMNVFVKDFRANLWLVEEPCMHYIRYPRKSI LASKGTSLFMNKWKLNLVTFWPWPFSVWFHPGRIWINQFPKHSLEILGYLSNVPMNPSGVRS
Physicochemical properties
Number of amino acids:		182
Molecular weight:		22,001.483
Theoretical pI:		10.135
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		61420 61545
Instability index:		48.435
aromaticity		0.181
GRAVY		-0.095
Secondary Structure Fraction
Helix		0.434
turn		0.269
sheet		0.203