Acc_NO	ORF type	length	start-end position (strand +/-)
>KC571809.1	internal	239	3-719(+)
Amino Acid sequence :
VSSLHLLRVFLNEYWNWNSFLTPKKVSFSLSKRNQRLFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLMNVFVKDFRANLWLVEEPCMHYIRYQRKSILASKGT SLFMNKWKLNLVTFWQWHFSVWFHPRRIWINQFPKHSLEILGYLSNVQMNPSVVRSQILENSFLINNAIKKLDTLVPIIPLIAELAKAKFCNVLGHPISKPIRAELSDSNIIDRFSRIC
Physicochemical properties
Number of amino acids:		239
Molecular weight:		28,570.152
Theoretical pI:		9.980
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		55920 56170
Instability index:		41.453
aromaticity		0.151
GRAVY		0.018
Secondary Structure Fraction
Helix		0.427
turn		0.234
sheet		0.218