Acc_NO	ORF type	length	start-end position (strand +/-)
>KC571810.1	internal	179	3-539(+)
Amino Acid sequence :
GKDDTSLHLLRVFLNEYWNWNSFLTPKKVSFSLSKRNHRLFFFLYNSPVCEYESIFVFLRNPSFHLRSTSSGVLLERIYFYIKIERLMNVFVKDFRANLWLVEEPCMPYIRYQRKSLLAS QGTSLFLNKWKLNLVTFWQWPYSVWLHPRRIWINHFPKLSLEILGYLSNVAMNPSVVRS
Physicochemical properties
Number of amino acids:		179
Molecular weight:		21,638.989
Theoretical pI:		9.962
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		57410 57535
Instability index:		44.566
aromaticity		0.179
GRAVY		-0.079
Secondary Structure Fraction
Helix		0.441
turn		0.251
sheet		0.223