| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KC571818.1 | internal | 123 | 3-371(+) |
Amino Acid sequence : | |||
| VKDVTSMHILRVFLNQYCSLITSKKVSSSLSKRNQRFFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLVNVFVKDFRANLWLVEEPCMHYIRYPGKSILASKGT SLF | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 14,622.914 | ||
| Theoretical pI: | 9.751 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 59.089 | ||
| aromaticity | 0.163 | ||
| GRAVY | 0.080 | ||
Secondary Structure Fraction | |||
| Helix | 0.431 | ||
| turn | 0.220 | ||
| sheet | 0.195 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KC571818.1 | internal | 123 | 3-371(+) |
Amino Acid sequence : | |||
| VKDVTSMHILRVFLNQYCSLITSKKVSSSLSKRNQRFFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLVNVFVKDFRANLWLVEEPCMHYIRYPGKSILASKGT SLF | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 14,622.914 | ||
| Theoretical pI: | 9.751 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 59.089 | ||
| aromaticity | 0.163 | ||
| GRAVY | 0.080 | ||
Secondary Structure Fraction | |||
| Helix | 0.431 | ||
| turn | 0.220 | ||
| sheet | 0.195 | ||