Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KC591661.1 | 5prime_partial | 201 | 1-606(+) |
Amino Acid sequence : | |||
RIIVETCKADRELVTNAAGHGTGETPCRVPSPAGLLPRGHAVRANEPRRGTRQGKPNEASAPGIPFAGRAVGSGVYQMSKRLSATDISALASMKNVAKCDTWCELQNPVNHRVFERKLRP KPLGRGHVCLGVTHRVAPHPRAHRRAVGGGHWPPVRLGVRPAQMRSPGDWRRDKWWLNISISLVVVPPCRPVRESKTTQRC* | |||
Physicochemical properties | |||
Number of amino acids: | 201 | ||
Molecular weight: | 11,617.043 | ||
Theoretical pI: | 11.662 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
Instability index: | 60.419 | ||
aromaticity | 0.108 | ||
GRAVY | -0.706 | ||
Secondary Structure Fraction | |||
Helix | 0.206 | ||
turn | 0.275 | ||
sheet | 0.137 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KC591661.1 | complete | 102 | 536-228(-) |
Amino Acid sequence : | |||
MFNHHLSRRQSPGDLIWAGRTPRRTGGQCPPPTARRCARGWGATRCVTPRQTCPRPNGFGRNLRSKTRWFTGFCNSHQVSHFATFFIDARAEISVAESRFDI* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,617.043 | ||
Theoretical pI: | 11.662 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
Instability index: | 60.419 | ||
aromaticity | 0.108 | ||
GRAVY | -0.706 | ||
Secondary Structure Fraction | |||
Helix | 0.206 | ||
turn | 0.275 | ||
sheet | 0.137 |