| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KC893719.1 | internal | 262 | 2-787(+) |
Amino Acid sequence : | |||
| YVSDILIPYPIHMEILVQILQCRIQDVPFLHLLRFFLHEYHNCNSLLITQNKSIYVFSNENKRLFQLLYNSYAFECEFLLVFFRKQSYYLRLTSSATFLERTHFYRKIEHLRIEHVVCRN YFHRTRWFFKNPFMHYVRYQRKAIVASRGTHFLMKKWKSHFVNFWQYYFRFWSRPYRIHINHLSNYSFYFLGYFSSLLINSSAVRNQMLENSFLMDTVTKKFDTIVPVILLIESLSKAKF CTVSGHPISKPIWADFSDSDII | |||
Physicochemical properties | |||
| Number of amino acids: | 262 | ||
| Molecular weight: | 31,982.828 | ||
| Theoretical pI: | 9.648 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 54320 54570 | ||
| Instability index: | 46.727 | ||
| aromaticity | 0.191 | ||
| GRAVY | -0.055 | ||
Secondary Structure Fraction | |||
| Helix | 0.435 | ||
| turn | 0.187 | ||
| sheet | 0.191 | ||