| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KC897689.1 | complete | 152 | 1-459(+) |
Amino Acid sequence : | |||
| MVKGVAVLNSSEGVSGTVLFSQEGDAPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPAGKEHGSPDDEVHHAGDLGNVTVGDDGKANFTIVDKMIPLCGPHSINGRAVVVHA DPDDVGRGGHELSKSTGNAGGRVACGIIGLQG* | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 15,249.731 | ||
| Theoretical pI: | 5.704 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 12.564 | ||
| aromaticity | 0.026 | ||
| GRAVY | -0.189 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.355 | ||
| sheet | 0.184 | ||