| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KC897690.1 | internal | 193 | 2-580(+) |
Amino Acid sequence : | |||
| GLQTFSLPDLPYDYGALEPAISGEIMQLHHQKHHQAYITNYNKALEQLDAAISTGDASTAVKLHSAIKFNGGGHVNHSIFWKNLAPIREGGGEPPKGSLAWAIDNHFGSLDALTQKMSAE GAALQGSGWVWLGLDKDFKSLVVETTANQDPLVTKGASLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVMNW | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 21,279.807 | ||
| Theoretical pI: | 6.120 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50420 50420 | ||
| Instability index: | 25.958 | ||
| aromaticity | 0.104 | ||
| GRAVY | -0.262 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.254 | ||
| sheet | 0.269 | ||