| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KC899529.1 | internal | 179 | 2-538(+) |
Amino Acid sequence : | |||
| KPSSLLCAAFLIEAAGLTPKAERFGLSRKGREGFKKNLAMRDLXXXKYCKRRGLLIELGGEAXILVIRSERPMXXKLAPLKTHDLLIRICYARYADDLLLGIVGAVELLIEIQKRITHFL QSGLNLWVGGAGSTTIAARSTVEFPGTVIREVPPRTTPIQFLRELEKRLRVKHRIHITA | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 19,363.784 | ||
| Theoretical pI: | 10.278 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 47.733 | ||
| aromaticity | 0.058 | ||
| GRAVY | 0.029 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.179 | ||
| sheet | 0.318 | ||