Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KC899529.1 | internal | 179 | 2-538(+) |
Amino Acid sequence : | |||
KPSSLLCAAFLIEAAGLTPKAERFGLSRKGREGFKKNLAMRDLXXXKYCKRRGLLIELGGEAXILVIRSERPMXXKLAPLKTHDLLIRICYARYADDLLLGIVGAVELLIEIQKRITHFL QSGLNLWVGGAGSTTIAARSTVEFPGTVIREVPPRTTPIQFLRELEKRLRVKHRIHITA | |||
Physicochemical properties | |||
Number of amino acids: | 179 | ||
Molecular weight: | 19,363.784 | ||
Theoretical pI: | 10.278 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 47.733 | ||
aromaticity | 0.058 | ||
GRAVY | 0.029 | ||
Secondary Structure Fraction | |||
Helix | 0.341 | ||
turn | 0.179 | ||
sheet | 0.318 |