Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KC899641.1 | internal | 140 | 2-421(+) |
Amino Acid sequence : | |||
HYPLIFQEYIYTIAYGHGLNGSIFDEPVEFLGCDNKSSSVLVKRLITRMYQQNYLVYSINDSNQNRSIGRNLFFYSPFFSXQMVSEGFAAIVEIPFSLQLGFSSKEKKIPKSHNLRSIHS IFPFLEDKFSHLNYVSDVLI | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 16,104.162 | ||
Theoretical pI: | 7.142 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13410 13410 | ||
Instability index: | 56.624 | ||
aromaticity | 0.158 | ||
GRAVY | -0.076 | ||
Secondary Structure Fraction | |||
Helix | 0.403 | ||
turn | 0.288 | ||
sheet | 0.180 |