| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KC899641.1 | internal | 140 | 2-421(+) |
Amino Acid sequence : | |||
| HYPLIFQEYIYTIAYGHGLNGSIFDEPVEFLGCDNKSSSVLVKRLITRMYQQNYLVYSINDSNQNRSIGRNLFFYSPFFSXQMVSEGFAAIVEIPFSLQLGFSSKEKKIPKSHNLRSIHS IFPFLEDKFSHLNYVSDVLI | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 16,104.162 | ||
| Theoretical pI: | 7.142 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13410 13410 | ||
| Instability index: | 56.624 | ||
| aromaticity | 0.158 | ||
| GRAVY | -0.076 | ||
Secondary Structure Fraction | |||
| Helix | 0.403 | ||
| turn | 0.288 | ||
| sheet | 0.180 | ||