| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KF020698.1 | complete | 364 | 147-1241(+) |
Amino Acid sequence : | |||
| MPEATTPFLPTMSDEATLRASFVRDEEERPKVAHDQFSDDIPIVSLEGLVGGKRAEICKKIVDACEDWGVFQVVDHGVDPELVTDMTRLAREFFSLPPEEKLRFDMSGGKKGGFIVSSHL QGEAVQDWREIVTYFSYPKNSRDYSRWPDKPEGWTAVAERYSDALMGLACRLLGVLSEAMGLETEALTKACVDMDQKMVINFYPKCPQPDLTLGLKRHTDPGTITLLLQDSVGGLQATKD GGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSSCSRLSIATFQNPAPEAVVYPLAIRGGERPILEEPMTFAEMYKRKMSRDIELAKMKKLAKEKQAQDLEKSKLESKPIE EILA* | |||
Physicochemical properties | |||
| Number of amino acids: | 364 | ||
| Molecular weight: | 14,185.099 | ||
| Theoretical pI: | 10.178 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 65.827 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.138 | ||
Secondary Structure Fraction | |||
| Helix | 0.235 | ||
| turn | 0.371 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KF020698.1 | complete | 276 | 938-108(-) |
Amino Acid sequence : | |||
| MTMVAKVNDEGAFYGLDSDPCLSAVLGGLKPADAILKEEGYGAGVSVALEAKSEVRLRALGVEVDDHLLVHVDAGLGQGLRLEPHGLRQHTEEPAGEPHQRVAVPLRHRRPPLRLVRPPR VVAGVFRVGEVCDDLPPVLHRLSLKVAGDDEAALLAAGHVEPQLLLRRQGEELAREPRHVGDELGVDPVVDHLEHPPVLAGVDDLLANLRPLPSDEALQRDDGDVVTELVVRHLRALLLV AHEARAQGCLVGHGREEGRRRLRHDVGGARFALSLS* | |||
Physicochemical properties | |||
| Number of amino acids: | 276 | ||
| Molecular weight: | 14,185.099 | ||
| Theoretical pI: | 10.178 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 65.827 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.138 | ||
Secondary Structure Fraction | |||
| Helix | 0.235 | ||
| turn | 0.371 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KF020698.1 | complete | 132 | 490-92(-) |
Amino Acid sequence : | |||
| MKPPFLPPDMSNLSFSSGGREKNSRASLVMSVTSSGSTPWSTTWNTPQSSQASTIFLQISALFPPTRPSSETMGMSSLNWSCATFGRSSSSRTKLARRVASSDMVGRKGVVASGMMLEVL ALLFLSLDHKCE* | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,185.099 | ||
| Theoretical pI: | 10.178 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 65.827 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.138 | ||
Secondary Structure Fraction | |||
| Helix | 0.235 | ||
| turn | 0.371 | ||
| sheet | 0.250 | ||