Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KF233542.1 | internal | 121 | 1-363(+) |
Amino Acid sequence : | |||
GLTSLDRYKGRCYHIEPVPGEESQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYEC L | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 13,571.521 | ||
Theoretical pI: | 9.014 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12045 | ||
Instability index: | 39.211 | ||
aromaticity | 0.116 | ||
GRAVY | -0.245 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.256 | ||
sheet | 0.248 |