| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KF233545.1 | internal | 197 | 1-591(+) |
Amino Acid sequence : | |||
| DYKLTYYTPDYQTLDTDILAAFRVTAQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEESQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDL RIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWR | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 22,060.669 | ||
| Theoretical pI: | 5.768 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34505 | ||
| Instability index: | 37.199 | ||
| aromaticity | 0.122 | ||
| GRAVY | -0.393 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.234 | ||
| sheet | 0.239 | ||