Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KF365991.1 | internal | 193 | 3-581(+) |
Amino Acid sequence : | |||
TETKASVGFKAGVKEYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNV FGFKALRALRLEDLRIPPAYIKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGL | |||
Physicochemical properties | |||
Number of amino acids: | 193 | ||
Molecular weight: | 21,416.230 | ||
Theoretical pI: | 9.006 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
Instability index: | 23.151 | ||
aromaticity | 0.114 | ||
GRAVY | -0.324 | ||
Secondary Structure Fraction | |||
Helix | 0.316 | ||
turn | 0.218 | ||
sheet | 0.244 |