Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KF381117.1 | internal | 193 | 3-581(+) |
Amino Acid sequence : | |||
TETKASVGFKAGVKDYKLTYYTPEYKTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYGIEKVIGEDNQYIAYVAYPLDLFEEGSVTNMFTSIVGNV FGFKALRALRLEDLRIPPAYSKTFEGPPHGIQAERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGL | |||
Physicochemical properties | |||
Number of amino acids: | 193 | ||
Molecular weight: | 21,221.907 | ||
Theoretical pI: | 8.623 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
Instability index: | 24.585 | ||
aromaticity | 0.114 | ||
GRAVY | -0.338 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.233 | ||
sheet | 0.249 |