| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KF381131.1 | internal | 193 | 3-581(+) |
Amino Acid sequence : | |||
| TETKASVGFKAGVKDYKLTYYTPDYVTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNV FGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYDGLRGGL | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 21,175.796 | ||
| Theoretical pI: | 8.313 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
| Instability index: | 27.090 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.313 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.244 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KF381131.1 | internal | 193 | 3-581(+) |
Amino Acid sequence : | |||
| TETKASVGFKAGVKDYKLTYYTPDYVTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNV FGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYDGLRGGL | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 21,175.796 | ||
| Theoretical pI: | 8.313 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
| Instability index: | 27.090 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.313 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.244 | ||
| sheet | 0.233 | ||