Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KF381148.1 | internal | 192 | 3-578(+) |
Amino Acid sequence : | |||
TETKASVGFKAGVKEYKLTYYTPDYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNV FGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGG | |||
Physicochemical properties | |||
Number of amino acids: | 192 | ||
Molecular weight: | 21,157.738 | ||
Theoretical pI: | 7.581 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
Instability index: | 29.536 | ||
aromaticity | 0.115 | ||
GRAVY | -0.362 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.234 | ||
sheet | 0.250 |