| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KF384797.1 | 3prime_partial | 195 | 1-585(+) |
Amino Acid sequence : | |||
| MEKIWHHTFLTMSFRVSLGGGAVSHKAPLNPKANREKMTQIMFETFSVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPMLFSDWTLQVAILQMHCCRSLPREATLSL LLQSGKLLGTYRRSLLISLLITSKSWRLLRAAPLYRRATELPDGQVITIGAERFRCPEVSPTFTIDWSMKCDVDI | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 11,744.533 | ||
| Theoretical pI: | 8.931 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 38.856 | ||
| aromaticity | 0.045 | ||
| GRAVY | 0.225 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.309 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KF384797.1 | complete | 110 | 584-252(-) |
Amino Acid sequence : | |||
| MSTSHFIDQSIVKVGETSGHRNLSAPIVITCPSGSSVALLYRGAALSSLQLLLVIKSDISKLLLYVPNNFPLCSSSERVASLGKDLQQCICKIATCKVQSENSMGRAYPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 11,744.533 | ||
| Theoretical pI: | 8.931 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 38.856 | ||
| aromaticity | 0.045 | ||
| GRAVY | 0.225 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.309 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KF384797.1 | 3prime_partial | 195 | 1-585(+) |
Amino Acid sequence : | |||
| MEKIWHHTFLTMSFRVSLGGGAVSHKAPLNPKANREKMTQIMFETFSVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPMLFSDWTLQVAILQMHCCRSLPREATLSL LLQSGKLLGTYRRSLLISLLITSKSWRLLRAAPLYRRATELPDGQVITIGAERFRCPEVSPTFTIDWSMKCDVDI | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 11,744.533 | ||
| Theoretical pI: | 8.931 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 38.856 | ||
| aromaticity | 0.045 | ||
| GRAVY | 0.225 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.309 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KF384797.1 | complete | 110 | 584-252(-) |
Amino Acid sequence : | |||
| MSTSHFIDQSIVKVGETSGHRNLSAPIVITCPSGSSVALLYRGAALSSLQLLLVIKSDISKLLLYVPNNFPLCSSSERVASLGKDLQQCICKIATCKVQSENSMGRAYPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 11,744.533 | ||
| Theoretical pI: | 8.931 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 38.856 | ||
| aromaticity | 0.045 | ||
| GRAVY | 0.225 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.309 | ||
| sheet | 0.236 | ||