Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KF432030.1 | internal | 192 | 3-578(+) |
Amino Acid sequence : | |||
TETKASVGFKAGVKDYKLTYYTPDYVPKDTDTLAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNV FGFKALRALRLEDLRIPIAYIKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLPGG | |||
Physicochemical properties | |||
Number of amino acids: | 192 | ||
Molecular weight: | 21,090.751 | ||
Theoretical pI: | 6.523 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
Instability index: | 25.442 | ||
aromaticity | 0.115 | ||
GRAVY | -0.277 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.234 | ||
sheet | 0.234 |