| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KF432035.1 | internal | 192 | 3-578(+) |
Amino Acid sequence : | |||
| TETKASVGFKAGVKDYKLTYYTPDYVTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNV FGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGG | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 21,122.756 | ||
| Theoretical pI: | 8.243 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
| Instability index: | 28.844 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.320 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.240 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KF432035.1 | internal | 192 | 3-578(+) |
Amino Acid sequence : | |||
| TETKASVGFKAGVKDYKLTYYTPDYVTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNV FGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGG | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 21,122.756 | ||
| Theoretical pI: | 8.243 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
| Instability index: | 28.844 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.320 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.240 | ||
| sheet | 0.234 | ||