Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KF442263.1 | complete | 249 | 188-937(+) |
Amino Acid sequence : | |||
MALSSTCFCHSQFSLKMDSWTPSLSSNILCYIRRNQLPASTLRTINPDLLSQQVQNRRTKHGNGWSFLGGSRVMCQPNLQILPQRRSYRVSAMWLPSSQVASSVFTLGTAGVLPFYTFMV AAPKAELTRKLMESAIPYVVLGLLYAYLLYLSWTPDTIRLMFASKYWLPELSGIAKMFSSEMTLASAWIHLLAVDLFAARQVYHDGLQNGIETRHSVSLCLLFCPIGIVVHLLTKAVQRS AEKTVPRTH* | |||
Physicochemical properties | |||
Number of amino acids: | 249 | ||
Molecular weight: | 27,977.436 | ||
Theoretical pI: | 9.723 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 46410 46785 | ||
Instability index: | 51.832 | ||
aromaticity | 0.100 | ||
GRAVY | 0.169 | ||
Secondary Structure Fraction | |||
Helix | 0.349 | ||
turn | 0.237 | ||
sheet | 0.277 |