Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KF442265.1 | 5prime_partial | 210 | 2-634(+) |
Amino Acid sequence : | |||
FFLSVLFAVDEVVGAVVFTPAMVSIMNVDRKISSEDEYIRRHHRHDVRDNQCSSSLVKHIKAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLD DDKHIFGVKIVGGDHRLRNYSSIITVHPEVIDGRPGTMVVESFVVDVPDGNTKDETCYFVEALIRCNLKSLADVSERLAVQGHMEPIDRM* | |||
Physicochemical properties | |||
Number of amino acids: | 210 | ||
Molecular weight: | 23,782.005 | ||
Theoretical pI: | 6.323 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
Instability index: | 33.325 | ||
aromaticity | 0.067 | ||
GRAVY | -0.146 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.205 | ||
sheet | 0.195 |