Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KF442270.1 | complete | 305 | 124-1041(+) |
Amino Acid sequence : | |||
MIGSFITRVLVMVFGYAYPAYECFKTVEMNKPDIQQLRFWCQYWILVAMLTVCERFGDAFISWVPMYSEAKLAFVIYLWCPKTKGTTYVYDAFFRPVILRHEPEIDKNLLELRTRAGDMF FLYWQKAASYGQTRVFDILQYIASQSNPPPPTQPQRQGSRGRQPTASLNRRSSASATLVQSEEQAPVASSESSSEDDADTSEEAESSKDPPPASTAAANAQKTTPSKSLVSTVAASLNTQ RASPSKALAETTKPSTSVETRVMQIDSVPSSANESGGNAPVETALEEAGRVTRARSRKTRTSNNP* | |||
Physicochemical properties | |||
Number of amino acids: | 305 | ||
Molecular weight: | 21,769.641 | ||
Theoretical pI: | 9.642 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 55460 55710 | ||
Instability index: | 57.107 | ||
aromaticity | 0.116 | ||
GRAVY | -0.050 | ||
Secondary Structure Fraction | |||
Helix | 0.398 | ||
turn | 0.144 | ||
sheet | 0.282 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KF442270.1 | complete | 181 | 1051-506(-) |
Amino Acid sequence : | |||
MTQIKGCLRSSSFLIWRVLLVLLPPRLSRQEHYHHFHWLRKAQNRSASLEFQQMWKVSWFQQGLWMEMLFVCSEKQLQSKPGIWTELFFVHLQLQWKPVEDLWRILPLLMYLHHPRLRIQ KKQRVLVLQIVPVLLKRMICDLVMLWVDDLYCLAFVAESGEVDLTAKQYTAKCRKPSSDHS* | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 21,769.641 | ||
Theoretical pI: | 9.642 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 55460 55710 | ||
Instability index: | 57.107 | ||
aromaticity | 0.116 | ||
GRAVY | -0.050 | ||
Secondary Structure Fraction | |||
Helix | 0.398 | ||
turn | 0.144 | ||
sheet | 0.282 |