| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KF454238.1 | 5prime_partial | 128 | 2-388(+) |
Amino Acid sequence : | |||
| SLTQLRPKPSGRGHVCLGVTHRVAPHPRAMRSAWGGRILASRAPRRAAGPNAIPRRPASRQVVVELINFPVAPRVVRADPLVKRTQAPRPRPQVRRDHPLSLSISISGGRETYKDSPSNG ERTGNSPT* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 13,950.863 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 54.686 | ||
| aromaticity | 0.023 | ||
| GRAVY | -0.682 | ||
Secondary Structure Fraction | |||
| Helix | 0.211 | ||
| turn | 0.336 | ||
| sheet | 0.188 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KF454238.1 | 5prime_partial | 128 | 2-388(+) |
Amino Acid sequence : | |||
| SLTQLRPKPSGRGHVCLGVTHRVAPHPRAMRSAWGGRILASRAPRRAAGPNAIPRRPASRQVVVELINFPVAPRVVRADPLVKRTQAPRPRPQVRRDHPLSLSISISGGRETYKDSPSNG ERTGNSPT* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 13,950.863 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 54.686 | ||
| aromaticity | 0.023 | ||
| GRAVY | -0.682 | ||
Secondary Structure Fraction | |||
| Helix | 0.211 | ||
| turn | 0.336 | ||
| sheet | 0.188 | ||