Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KF620680.1 | complete | 99 | 237-536(+) |
Amino Acid sequence : | |||
MTNQEIEFTNLIMLRLLPSFLLGPGVGICLSHIFSLMVNLPLLPLLTLGSTFSTTFPPSAAPKVLGLAPSFIFPKWSIPGKLRYGTVFLRGLRTRLELK* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 10,928.081 | ||
Theoretical pI: | 10.532 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 43.427 | ||
aromaticity | 0.101 | ||
GRAVY | 0.610 | ||
Secondary Structure Fraction | |||
Helix | 0.414 | ||
turn | 0.293 | ||
sheet | 0.303 |