Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KF620948.1 | complete | 106 | 133-453(+) |
Amino Acid sequence : | |||
MKDWRGGRAASFNIIPSSTGAAKVTYYFTLSNDVHVVLLDLYQHGCXVTLVACYLSTQAVGKVIPALNGKLTGMAFRVPTVDVSVVDLTVRLEKXATYEEIKKAIK* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,335.116 | ||
Theoretical pI: | 9.199 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 14.817 | ||
aromaticity | 0.087 | ||
GRAVY | 0.263 | ||
Secondary Structure Fraction | |||
Helix | 0.365 | ||
turn | 0.183 | ||
sheet | 0.240 |