Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KF632754.1 | internal | 193 | 1-579(+) |
Amino Acid sequence : | |||
LFLEQFHKQIFPSTPITSFFLFLSYIVVTPLMIGFEKDFSCHSHLGSIRIPLLFPFPPEPFPRNDKESGTLELYYLSAYCLPKILLLQLVGHRVIQISRVFCAFPMLQLPYQFDRSGMDR LNILLGSPVLTLLCGIHSRSALGITSSSGWNSSQNPTTSPTLLPPTVSRTSIETEGFHVLSSIGYSSPFVSLY | |||
Physicochemical properties | |||
Number of amino acids: | 193 | ||
Molecular weight: | 21,633.935 | ||
Theoretical pI: | 7.885 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16180 | ||
Instability index: | 63.774 | ||
aromaticity | 0.124 | ||
GRAVY | 0.294 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.306 | ||
sheet | 0.218 |