Acc_NO	ORF type	length	start-end position (strand +/-)
>KF735672.1	5prime_partial	211	1-636(+)
Amino Acid sequence :
NKVSVGEPAEGSLLEPCKADRELVTNAAGHGTGETPCRIPSPAGLLPRGHAVRANEPRRGTRQGKPNEASAPGIPFAGRAVGSGVYQMSKRLSATDISALASMKNVAKCDTWCELQNPVN HRVFERKLRPKPLGRGHVCLGVTHRVAPHPRAHRRAVGGGHWPPVRLGVRPAQMRSPGDWRRDKWWLNISISLVVVPPCRPVRESKTTQRC*
Physicochemical properties
Number of amino acids:		211
Molecular weight:		11,617.043
Theoretical pI:		11.662
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16500 16750
Instability index:		60.419
aromaticity		0.108
GRAVY		-0.706
Secondary Structure Fraction
Helix		0.206
turn		0.275
sheet		0.137

Acc_NO	ORF type	length	start-end position (strand +/-)
>KF735672.1	complete	102	566-258(-)
Amino Acid sequence :
MFNHHLSRRQSPGDLIWAGRTPRRTGGQCPPPTARRCARGWGATRCVTPRQTCPRPNGFGRNLRSKTRWFTGFCNSHQVSHFATFFIDARAEISVAESRFDI*
Physicochemical properties
Number of amino acids:		102
Molecular weight:		11,617.043
Theoretical pI:		11.662
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16500 16750
Instability index:		60.419
aromaticity		0.108
GRAVY		-0.706
Secondary Structure Fraction
Helix		0.206
turn		0.275
sheet		0.137