| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KF886672.1 | internal | 211 | 2-634(+) |
Amino Acid sequence : | |||
| TYYTPEYETKDTDILAAFRVTPQPGVPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVVGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPP AYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALYKAQAETG | |||
Physicochemical properties | |||
| Number of amino acids: | 211 | ||
| Molecular weight: | 23,605.357 | ||
| Theoretical pI: | 5.534 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36120 | ||
| Instability index: | 30.626 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.378 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.213 | ||
| sheet | 0.265 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KF886672.1 | internal | 211 | 2-634(+) |
Amino Acid sequence : | |||
| TYYTPEYETKDTDILAAFRVTPQPGVPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVVGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPP AYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALYKAQAETG | |||
Physicochemical properties | |||
| Number of amino acids: | 211 | ||
| Molecular weight: | 23,605.357 | ||
| Theoretical pI: | 5.534 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36120 | ||
| Instability index: | 30.626 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.378 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.213 | ||
| sheet | 0.265 | ||