Acc_NO	ORF type	length	start-end position (strand +/-)
>KF892820.1	internal	181	1-543(+)
Amino Acid sequence :
SLYFRKLNPAIFRGSENPLDAKQWLIHTEGLLKAALIPDREKIDIVQIQLYDNARTWWQTEETCRPTTSWEEFKRRFLANFFLRTAKTLMAHQFMNLTQGNLSVDDYSSEFTYLARFAPH LVSTEDDRAMKFKDGLNYEIQRLVMSHYYPTFAEVMDAAQDHEKLTLRHLEAPQFFKDPYI
Physicochemical properties
Number of amino acids:		181
Molecular weight:		21,477.154
Theoretical pI:		6.067
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		33920 33920
Instability index:		35.618
aromaticity		0.138
GRAVY		-0.504
Secondary Structure Fraction
Helix		0.320
turn		0.149
sheet		0.293