Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KF916013.1 | complete | 226 | 1-681(+) |
Amino Acid sequence : | |||
MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANNSVKGTIDRYKKACTDTSNSGTVSEANSQYYQQEASKLLQQIAQLQNSNRNLMGESLSTMS PRELRQLEGKLEKGINKIRAKKNELLYAEIEYMQKREMELQNDNMYLRNKISENERAQQHMNMLPSATATEYEAMPPFDSRSFLQANLVDPNHHYSHQQRTALQLG* | |||
Physicochemical properties | |||
Number of amino acids: | 226 | ||
Molecular weight: | 26,080.244 | ||
Theoretical pI: | 9.248 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16390 16515 | ||
Instability index: | 59.769 | ||
aromaticity | 0.066 | ||
GRAVY | -0.843 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.226 | ||
sheet | 0.301 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KF916013.1 | complete | 226 | 1-681(+) |
Amino Acid sequence : | |||
MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANNSVKGTIDRYKKACTDTSNSGTVSEANSQYYQQEASKLLQQIAQLQNSNRNLMGESLSTMS PRELRQLEGKLEKGINKIRAKKNELLYAEIEYMQKREMELQNDNMYLRNKISENERAQQHMNMLPSATATEYEAMPPFDSRSFLQANLVDPNHHYSHQQRTALQLG* | |||
Physicochemical properties | |||
Number of amino acids: | 226 | ||
Molecular weight: | 26,080.244 | ||
Theoretical pI: | 9.248 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16390 16515 | ||
Instability index: | 59.769 | ||
aromaticity | 0.066 | ||
GRAVY | -0.843 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.226 | ||
sheet | 0.301 |