| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KF916013.1 | complete | 226 | 1-681(+) |
Amino Acid sequence : | |||
| MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANNSVKGTIDRYKKACTDTSNSGTVSEANSQYYQQEASKLLQQIAQLQNSNRNLMGESLSTMS PRELRQLEGKLEKGINKIRAKKNELLYAEIEYMQKREMELQNDNMYLRNKISENERAQQHMNMLPSATATEYEAMPPFDSRSFLQANLVDPNHHYSHQQRTALQLG* | |||
Physicochemical properties | |||
| Number of amino acids: | 226 | ||
| Molecular weight: | 26,080.244 | ||
| Theoretical pI: | 9.248 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16390 16515 | ||
| Instability index: | 59.769 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.843 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.226 | ||
| sheet | 0.301 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KF916013.1 | complete | 226 | 1-681(+) |
Amino Acid sequence : | |||
| MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANNSVKGTIDRYKKACTDTSNSGTVSEANSQYYQQEASKLLQQIAQLQNSNRNLMGESLSTMS PRELRQLEGKLEKGINKIRAKKNELLYAEIEYMQKREMELQNDNMYLRNKISENERAQQHMNMLPSATATEYEAMPPFDSRSFLQANLVDPNHHYSHQQRTALQLG* | |||
Physicochemical properties | |||
| Number of amino acids: | 226 | ||
| Molecular weight: | 26,080.244 | ||
| Theoretical pI: | 9.248 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16390 16515 | ||
| Instability index: | 59.769 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.843 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.226 | ||
| sheet | 0.301 | ||